PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA13325
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family WRKY
Protein Properties Length: 157aa    MW: 18316.9 Da    PI: 10.2263
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA13325genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY99.22.6e-3171129159
                                ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                       WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                ldDg++WrKYG K+vk+++fprsYY+Ct++gC+vkk+++r ++++++ve+tYeg H h+
  Tp57577_TGAC_v2_mRNA13325  71 LDDGFRWRKYGEKSVKNNKFPRSYYKCTYRGCNVKKQIQRHSKEEQIVETTYEGVHIHP 129
                                59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.3E-3157129IPR003657WRKY domain
SuperFamilySSF1182901.57E-2763130IPR003657WRKY domain
PROSITE profilePS5081127.71466131IPR003657WRKY domain
SMARTSM007741.8E-3571130IPR003657WRKY domain
PfamPF031062.6E-2572129IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 157 aa     Download sequence    Send to blast
MMERHEVIFP ISSSKDASPI DVKPGNASNI HAKKAELFLK TIRKETSKQK GGKEIMKHRY  60
VFQTRSQIDI LDDGFRWRKY GEKSVKNNKF PRSYYKCTYR GCNVKKQIQR HSKEEQIVET  120
TYEGVHIHPV EKSTESFDQI LRNFITSNQL YNVTAM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-2562128874Probable WRKY transcription factor 4
2lex_A2e-2562128874Probable WRKY transcription factor 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013446987.14e-90WRKY family transcription factor
SwissprotQ9FYA21e-45WRK75_ARATH; Probable WRKY transcription factor 75
TrEMBLA0A072TU164e-90A0A072TU16_MEDTR; Uncharacterized protein
STRINGGLYMA08G01430.11e-62(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF115634110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.18e-47WRKY DNA-binding protein 75